SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000292539 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000292539
Domain Number 1 Region: 74-305
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.33e-55
Family Ankyrin repeat 0.00000529
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000292539
Sequence length 528
Comment (Homo sapiens)
Sequence
MAEHLELLAEMPMVGRMSTQERLKHAQKRRAQQVKMWAQAEKEAQGKKGPGERPRKEAAS
QGLLKQVLFPPSVVLLEAAARNDLEEVRQFLGSGVSPDLANEDGLTALHQCCIDDFREMV
QQLLEAGANINACDSECWTPLHAAATCGHLHLVELLIASGANLLAVNTDGNMPYDLCDDE
QTLDCLETAMADRGITQDSIEAARAVPELRMLDDIRSRLQAGADLHAPLDHGATLLHVAA
ANGFSEAAALLLEHRASLSAKDQDGWEPLHAAAYWGQVPLVELLVAHGADLNAKSLMDET
PLDVCGDEEVRAKLLELKHKHDALLRAQSRQRSLLRRRTSSAGSRGKVVRRVSLTQRTDL
YRKQHAQEAIVWQQPPPTSPEPPEDNDDRQTGAELRPPPPEEDNPEVVRPHNGRVGGSPV
RHLYSKRLDRSVSYQLSPLDSTTPHTLVHDKAHHTLADLKRQRAAAKLQRPPPEGPESPE
TAEPGLPGDTVTPQPDCGFRAGGDPPLLKLTAPAVEAPVERRPCCLLM
Download sequence
Identical sequences Q96I34
NP_116291.1.87134 NP_116291.1.92137 XP_005272407.1.92137 XP_016869401.1.92137 XP_016869402.1.92137 XP_016869403.1.92137 XP_016869404.1.92137 9606.ENSP00000292539 ENSP00000292539 ENSP00000391126 gi|14249672|ref|NP_116291.1| ENSP00000292539 ENSP00000292539 ENSP00000391126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]