SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000296111 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000296111
Domain Number 1 Region: 50-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.58e-35
Family SCAN domain 0.00011
Further Details:      
 
Domain Number 2 Region: 228-289
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-22
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 493-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-20
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 4 Region: 761-812
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 678-727
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-17
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 976-1028
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.1e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 605-662
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.65e-16
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 8 Region: 862-914
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000119
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 9 Region: 832-877
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000386
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 10 Region: 444-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000344
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 11 Region: 535-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000126
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  9606.ENSP00000296111
Domain Number - Region: 953-987
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0476
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000296111
Sequence length 1031
Comment (Homo sapiens)
Sequence
MPPGRWHAAYPAQAQSSRERGRLQTVKKEEEDESYTPVQAARPQTLNRPGQELFRQLFRQ
LRYHESSGPLETLSRLRELCRWWLRPDVLSKAQILELLVLEQFLSILPGELRVWVQLHNP
ESGEEAVALLEELQRDLDGTSWRDPGPAQSPDVHWMGTGALRSAQIWSLASPLRSSSALG
DHLEPPYEIEARDFLAGQSDTPAAQMPALFPREGCPGDQVTPTRSLTAQLQETMTFKDVE
VTFSQDEWGWLDSAQRNLYRDVMLENYRNMASLVGPFTKPALISWLEAREPWGLNMQAAQ
PKGNPVAAPTGDDLQSKTNKFILNQEPLEEAETLAVSSGCPATSVSEGIGLRESFQQKSR
QKDQCENPIQVRVKKEETNFSHRTGKDSEVSGSNSLDLKHVTYLRVSGRKESLKHGCGKH
FRMSSHHYDYKKYGKGLRHMIGGFSLHQRIHSGLKGNKKDVCGKDFSLSSHHQRGQSLHT
VGVSFKCSDCGRTFSHSSHLAYHQRLHTQEKAFKCRVCGKAFRWSSNCARHEKIHTGVKP
YKCDLCEKAFRRLSAYRLHRETHAKKKFLELNQYRAALTYSSGFDHHLGDQSGEKLFDCS
QCRKSFHCKSYVLEHQRIHTQEKPYKCTKCRKTFRWRSNFTRHMRLHEEEKFYKQDECRE
GFRQSPDCSQPQGAPAVEKTFLCQQCGKTFTRKKTLVDHQRIHTGEKPYQCSDCGKDFAY
RSAFIVHKKKHAMKRKPEGGPSFSQDTVFQVPQSSHSKEEPYKCSQCGKAFRNHSFLLIH
QRVHTGEKPYKCRECGKAFRWSSNLYRHQRIHSLQKQYDCHESEKTPNVEPKILTGEKRF
WCQECGKTFTRKRTLLDHKGIHSGEKRYKCNLCGKSYDRNYRLVNHQRIHSTERPFKCQW
CGKEFIGRHTLSSHQRKHTRAAQAERSPPARSSSQDTKLRLQKLKPSEEMPLEDCKEACS
QSSRLTGLQDISIGKKCHKCSICGKTFNKSSQLISHKRFHTRERPFKCSKCGKTFRWSSN
LARHMKNHIRD
Download sequence
Identical sequences P59923
ENSP00000379387 ENSP00000413073 ENSP00000379387 ENSP00000413073 gi|31340735|ref|NP_852466.1| NP_852466.1.87134 NP_852466.1.92137 XP_005265159.1.92137 XP_011531976.1.92137 9606.ENSP00000296111 ENSP00000379387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]