SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000297404 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000297404
Domain Number 1 Region: 203-432
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.56e-55
Family Voltage-gated potassium channels 0.00075
Further Details:      
 
Domain Number 2 Region: 40-158
Classification Level Classification E-value
Superfamily POZ domain 2.38e-28
Family Tetramerization domain of potassium channels 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000297404
Sequence length 500
Comment (Homo sapiens)
Sequence
MPSSGRALLDSPLDSGSLTSLDSSVFCSEGEGEPLALGDCFTVNVGGSRFVLSQQALSCF
PHTRLGKLAVVVASYRRPGALAAVPSPLELCDDANPVDNEYFFDRSSQAFRYVLHYYRTG
RLHVMEQLCALSFLQEIQYWGIDELSIDSCCRDRYFRRKELSETLDFKKDTEDQESQHES
EQDFSQGPCPTVRQKLWNILEKPGSSTAARIFGVISIIFVVVSIINMALMSAELSWLDLQ
LLEILEYVCISWFTGEFVLRFLCVRDRCRFLRKVPNIIDLLAILPFYITLLVESLSGSQT
TQELENVGRIVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLLLFLSVGISIF
STVEYFAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGKIVAFMCILSGILVL
ALPIAIINDRFSACYFTLKLKEAAVRQREALKKLTKNIATDSYISVNLRDVYARSIMEML
RLKGRERASTRSSGGDDFWF
Download sequence
Identical sequences A0A096N5E8 A0A2J8X351 A0A2K5ZTE2 G7PCI9 Q5RC10 Q6PIU1 Q9GKU7
ENSP00000297404 ENSP00000297404 ENSP00000435954 ENSP00000297404 ENSP00000435954 gi|7657289|ref|NP_055194.1| ENSPPYP00000021123 ENSMMUP00000024617 NP_001125386.1.23681 NP_001274541.1.63531 NP_055194.1.87134 NP_055194.1.92137 XP_001091899.1.72884 XP_004047497.1.27298 XP_005564006.1.63531 XP_009242310.1.23681 XP_010364991.1.97406 XP_011729800.1.29376 XP_011789741.1.43180 XP_011823751.1.47321 XP_011912770.1.92194 XP_017747010.1.44346 ENSPPYP00000021123 9544.ENSMMUP00000024617 9600.ENSPPYP00000021123 9606.ENSP00000297404 ENSMMUP00000024617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]