SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000298545 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000298545
Domain Number 1 Region: 270-468
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.01e-26
Family Nucleotide and nucleoside kinases 0.00043
Further Details:      
 
Domain Number 2 Region: 56-178,211-259
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.79e-21
Family Nucleotide and nucleoside kinases 0.0015
Further Details:      
 
Domain Number 3 Region: 392-420
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0000000471
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0017
Further Details:      
 
Domain Number 4 Region: 177-205
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0000000746
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0028
Further Details:      
 
Weak hits

Sequence:  9606.ENSP00000298545
Domain Number - Region: 13-51
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000392
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000298545
Sequence length 479
Comment (Homo sapiens)
Sequence
MDATIAPHRIPPEMPQYGEENHIFELMQNMLEQLLIHQPEDPIPFMIQHLHRDNDNVPRI
VILGPPASGKTTIAMWLCKHLNSSLLTLENLILNEFSYTATEARRLYLQRKTVPSALLVQ
LIQERLAEEDCIKQGWILDGIPETREQALRIQTLGITPRHVIVLSAPDTVLIERNLGKRI
DPQTGEIYHTTFDWPPESEIQNRLMVPEDISELETAQKLLEYHRNIVRVIPSYPKILKVI
SADQPCVDVFYQALTYVQSNHRTNAPFTPRVLLLGPVGSGKSLQAALLAQKYRLVNVCCG
QLLKEAVADRTTFGELIQPFFEKEMAVPDSLLMKVLSQRLDQQDCIQKGWVLHGVPRDLD
QAHLLNRLGYNPNRVFFLNVPFDSIMERLTLRRIDPVTGERYHLMYKPPPTMEIQARLLQ
NPKDAEEQVKLKMDLFYRNSADLEQLYGSAITLNGDQDPYTVFEYIESGIINPLPKKIP
Download sequence
Identical sequences Q96MA6
400137 ENSP00000298545 gi|22749187|ref|NP_689785.1| 9606.ENSP00000298545 ENSP00000298545 ENSP00000298545 NP_689785.1.87134 NP_689785.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]