SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000301042 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000301042
Domain Number 1 Region: 262-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-16
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 104-166
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-16
Family KRAB domain (Kruppel-associated box) 0.0036
Further Details:      
 
Domain Number 3 Region: 370-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000716
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 300-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000728
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000301042
Sequence length 438
Comment (Homo sapiens)
Sequence
MQAEDRSQFGSAAEMLSEQTAALGTGWESMNVQLDGAEPQVERGSQEERPWRTVPGPLEH
LCCDLEEEPQSLQEKAQSAPWVPAIPQEGNTGDWEMAAALLAAGSQGLVTIKDVSLCFSQ
EEWRSLDPSQTDFYGEYVMQENCGIVVSLRFPIPKLDMLSQLEGGEEQWVPDPQDLEERD
ILRVTYTGDGSEHEGDTPELEAEPPRMLSSVSEDTVLWNPEHDESWDSMPSSSRGMLLGP
PFLQEDSFSNLLCSTEMDSLLRPHTCPQCGKQFVWGSHLARHQQTHTGERPYSCLKCEKT
FGRRHHLIRHQKTHLHDKTSRCSECGKNFRCNSHLASHQRVHAEGKSCKGQEVGESPGTR
KRQRAPPVPKCHVCTECGKSFGRRHHLVRHWLTHTGEKPFQCPRCEKSFGRKHHLDRHLL
THQGQSPRNSWDRGTSVF
Download sequence
Identical sequences Q96N77
ENSP00000301042 ENSP00000437832 NP_689533.2.87134 NP_689533.2.92137 XP_011536199.1.92137 ENSP00000301042 ENSP00000437832 gi|289547731|ref|NP_689533.2| ENSP00000301042 9606.ENSP00000301042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]