SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000313881 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000313881
Domain Number 1 Region: 310-369
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000773
Family RING finger domain, C3HC4 0.025
Further Details:      
 
Domain Number 2 Region: 96-120
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000366
Family CCCH zinc finger 0.0033
Further Details:      
 
Weak hits

Sequence:  9606.ENSP00000313881
Domain Number - Region: 241-263
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000392
Family CCCH zinc finger 0.0049
Further Details:      
 
Domain Number - Region: 395-424
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000549
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000313881
Sequence length 507
Comment (Homo sapiens)
Sequence
MEEPAAPSEAHEAAGAQAGAEAAREGVSGPDLPVCEPSGESAAPDSALPHAARGWAPFPV
APVPAHLRRGGLRPAPASGGGAWPSPLPSRSSGIWTKQIICRYYIHGQCKEGENCRYSHD
LSGRKMATEGGVSPPGASAGGGPSTAAHIEPPTQEVAEAPPAASSLSLPVIGSAAERGFF
EAERDNADRGAAGGAGVESWADAIEFVPGQPYRGRWVASAPEAPLQSSETERKQMAVGSG
LRFCYYASRGVCFRGESCMYLHGDICDMCGLQTLHPMDAAQREEHMRACIEAHEKDMELS
FAVQRGMDKVCGICMEVVYEKANPNDRRFGILSNCNHSFCIRCIRRWRSARQFENRIVKS
CPQCRVTSELVIPSEFWVEEEEEKQKLIQQYKEAMSNKACRYFAEGRGNCPFGDTCFYKH
EYPEGWGDEPPGPGGGSFSAYWHQLVEPVRMGEGNMLYKSIKKELVVLRLASLLFKRFLS
LRDELPFSEDQWDLLHYELEEYFNLIL
Download sequence
Identical sequences Q13064
gi|5032243|ref|NP_005655.1| ENSP00000313881 9606.ENSP00000313881 NP_005655.1.87134 NP_005655.1.92137 ENSP00000313881 ENSP00000313881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]