SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000318846 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000318846
Domain Number 1 Region: 92-163
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.32e-17
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000318846
Sequence length 181
Comment (Homo sapiens)
Sequence
MMDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPS
DSLILGNYSEPCPFSFPMPYPNYRGCEYSYGPAFTRKRNERERQRVKCVNEGYAQLRHHL
PEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKVSSMIATTSHHADPMFRI
V
Download sequence
Identical sequences NYSGRC-10190680 NP_065697.1.87134 NP_065697.1.92137 ENSP00000435770 ENSP00000318846 ENSP00000435770 9606.ENSP00000318846 ENSP00000318846 gi|10190680|ref|NP_065697.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]