SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000319308 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000319308
Domain Number 1 Region: 54-180
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.2e-45
Family Regulator of G-protein signaling, RGS 0.00000814
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000319308
Sequence length 181
Comment (Homo sapiens)
Sequence
MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQ
WRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEF
IQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELI
K
Download sequence
Identical sequences A0A024R8X9 O15539
ENSP00000319308 ENSP00000319308 gi|4506519|ref|NP_003608.1| NP_003608.1.87134 NP_003608.1.92137 9606.ENSP00000319308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]