SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000321445 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000321445
Domain Number 1 Region: 105-182
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.49e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000321445
Sequence length 206
Comment (Homo sapiens)
Sequence
MSTGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNSSAEEEDPDGEEERCA
LGTAGSAEGCKRKRPRVAGGGGAGGSAGGGGKKPLPAKGSAAECKQSQRNAANARERARM
RVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTW
PFVVSGRPDSDTKEVSAANRLCGTTA
Download sequence
Identical sequences K7A6B3 O60682
ENSP00000321445 ENSGGOP00000009716 ENSPTRP00000040250 gi|116805332|ref|NP_005089.2| NP_005089.2.87134 NP_005089.2.92137 XP_003831377.1.60992 XP_004047190.1.27298 XP_016815055.1.37143 9598.ENSPTRP00000040250 9606.ENSP00000321445 ENSGGOP00000009716 ENSP00000321445 ENSP00000321445 ENSPTRP00000040250 HR4485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]