SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000327290 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000327290
Domain Number 1 Region: 23-139,329-637
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 6.02e-73
Family Integrin alpha N-terminal domain 0.0000484
Further Details:      
 
Domain Number 2 Region: 159-353
Classification Level Classification E-value
Superfamily vWA-like 3.06e-51
Family Integrin A (or I) domain 0.000000892
Further Details:      
 
Domain Number 3 Region: 637-783
Classification Level Classification E-value
Superfamily Integrin domains 1.31e-30
Family Integrin domains 0.004
Further Details:      
 
Domain Number 4 Region: 784-797,826-945
Classification Level Classification E-value
Superfamily Integrin domains 9.94e-22
Family Integrin domains 0.0042
Further Details:      
 
Domain Number 5 Region: 964-1145
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000000204
Family Integrin domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000327290
Sequence length 1188
Comment (Homo sapiens)
Sequence
MDLPRGLVVAWALSLWPGFTDTFNMDTRKPRVIPGSRTAFFGYTVQQHDISGNKWLVVGA
PLETNGYQKTGDVYKCPVIHGNCTKLNLGRVTLSNVSERKDNMRLGLSLATNPKDNSFLA
CSPLWSHECGSSYYTTGMCSRVNSNFRFSKTVAPALQRCQTYMDIVIVLDGSNSIYPWVE
VQHFLINILKKFYIGPGQIQVGVVQYGEDVVHEFHLNDYRSVKDVVEAASHIEQRGGTET
RTAFGIEFARSEAFQKGGRKGAKKVMIVITDGESHDSPDLEKVIQQSERDNVTRYAVAVL
GYYNRRGINPETFLNEIKYIASDPDDKHFFNVTDEAALKDIVDALGDRIFSLEGTNKNET
SFGLEMSQTGFSSHVVEDGVLLGAVGAYDWNGAVLKETSAGKVIPLRESYLKEFPEELKN
HGAYLGYTVTSVVSSRQGRVYVAGAPRFNHTGKVILFTMHNNRSLTIHQAMRGQQIGSYF
GSEITSVDIDGDGVTDVLLVGAPMYFNEGRERGKVYVYELRQNLFVYNGTLKDSHSYQNA
RFGSSIASVRDLNQDSYNDVVVGAPLEDNHAGAIYIFHGFRGSILKTPKQRITASELATG
LQYFGCSIHGQLDLNEDGLIDLAVGALGNAVILWSRPVVQINASLHFEPSKINIFHRDCK
RSGRDATCLAAFLCFTPIFLAPHFQTTTVGIRYNATMDERRYTPRAHLDEGGDRFTNRAV
LLSSGQELCERINFHVLDTADYVKPVTFSVEYSLEDPDHGPMLDDGWPTTLRVSVPFWNG
CNEDEHCVPDLVLDARSDLPTAMEYCQRVLRKPAQDCSAYTLSFDTTVFIIESTRQRVAV
EATLENRGENAYSTVLNISQSANLQFASLIQKEDSDGSIECVNEERRLQKQVCNVSYPFF
RAKAKVAFRLDFEFSKSIFLHHLEIELAAGSDSNERDSTKEDNVAPLRFHLKYEADVLFT
RSSSLSHYEVKPNSSLERYDGIGPPFSCIFRIQNLGLFPIHGMMMKITIPIATRSGNRLL
KLRDFLTDEANTSCNIWGNSTEYRPTPVEEDLRRAPQLNHSNSDVVSINCNIRLVPNQEI
NFHLLGNLWLRSLKALKYKSMKIMVNAALQRQFHSPFIFREEDPSRQIVFEISKQEDWQV
PIWIIVGSTLGGLLLLALLVLALWKLGFFRSARRRREPGLDPTPKVLE
Download sequence
Identical sequences Q9UKX5
ENSP00000327290 NP_001004439.1.87134 NP_001004439.1.92137 gi|52485853|ref|NP_001004439.1| ENSP00000327290 9606.ENSP00000327290 NYSGRC-52485853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]