SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000331504 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000331504
Domain Number 1 Region: 549-818
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.26e-81
Family Protein kinases, catalytic subunit 0.000000947
Further Details:      
 
Domain Number 2 Region: 12-283
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.4e-54
Family FCH domain 0.0099
Further Details:      
 
Domain Number 3 Region: 441-578
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-27
Family SH2 domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000331504
Sequence length 822
Comment (Homo sapiens)
Sequence
MGFSSELCSPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQS
RAISPDSPISQSWAEITSQTEGLSRLLRQHAEDLNSGPLSKLSLLIRERQQLRKTYSEQW
QQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLF
AHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDE
VVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEPGELQLNE
LTVESVQHTLTSVTDELAVATEMVFRRQEMVTQLQQELRNEEENTHPRERVQLLGKRQVL
QEALQGLQVALCSQAKLQAQQELLQTKLEHLGPGEPPPVLLLQDDRHSTSSSEQEREGGR
TPTLEILKSHISGIFRPKFSLPPPLQLIPEVQKPLHEQLWYHGAIPRAEVAELLVHSGDF
LVRESQGKQEYVLSVLWDGLPRHFIIQSLDNLYRLEGEGFPSIPLLIDHLLSTQQPLTKK
SGVVLHRAVPKDKWVLNHEDLVLGEQIGRGNFGEVFSGRLRADNTLVAVKSCRETLPPDL
KAKFLQEARILKQYSHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRTEGARLRVKTL
LQMVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVLKISDFGMSREEADGVYAASGGLR
QVPVKWTAPEALNYGRYSSESDVWSFGILLWETFSLGASPYPNLSNQQTREFVEKGGRLP
CPELCPDAVFRLMEQCWAYEPGQRPSFSTIYQELQSIRKRHR
Download sequence
Identical sequences A0A024RC92 P07332
ENSP00000377837 HR4587 hss001002011.1 9606.ENSP00000331504 gi|4503687|ref|NP_001996.1| ENSP00000331504 NP_001996.1.87134 NP_001996.1.92137 XP_016877494.1.92137 XP_016877498.1.92137 ENSP00000331504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]