SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000333097 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000333097
Domain Number 1 Region: 65-131
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.1e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000333097
Sequence length 219
Comment (Homo sapiens)
Sequence
MDPAPGVLDPRAAPPALLGTPQAEVLEDVLREQFGPLPQLAAVCRLKRLPSGGYSSTENL
QLVLERRRVANAKERERIKNLNRGFARLKALVPFLPQSRKPSKVDILKGATEYIQVLSDL
LEGAKDSKKQDPDEQSYSNNSSESHTSSARQLSRNITQHISCAFGLKNEEEGPWADGGSG
EPAHACRHSVMSTTEIISPTRSLDRFPEVELLSHRLPQV
Download sequence
Identical sequences Q6QHK4
NP_001004311.2.87134 NP_001004311.2.92137 ENSP00000333097 9606.ENSP00000333097 gi|116517330|ref|NP_001004311.2| ENSP00000333097 ENSP00000475436 ENSP00000333097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]