SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000334800 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000334800
Domain Number 1 Region: 35-123
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.85e-37
Family SCAN domain 0.0000596
Further Details:      
 
Domain Number 2 Region: 439-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.32e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 480-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-19
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 384-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-19
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 346-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.83e-16
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 6 Region: 224-258
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000183
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000334800
Sequence length 544
Comment (Homo sapiens)
Sequence
MLKEHPEMAEAPQQQLGIPVVKLEKELPWGRGREDPSPETFRLRFRQFRYQEAAGPQEAL
RELQELCRRWLRPELHTKEQILELLVLEQFLTILPREFYAWIREHGPESGKALAAMVEDL
TERALEAKAVPCHRQGEQEETALCRGAWEPGIQLGPVEVKPEWGMPPGEGVQGPDPGTEE
QLSQDPGDETRAFQEQALPVLQAGPGLPAVNPRDQEMAAGFFTAGSQGLGPFKDMALAFP
EEEWRHVTPAQIDCFGEYVEPQDCRVSPGGGSKEKEAKPPQEDLKGALVALTSERFGEAS
LQGPGLGRVCEQEPGGPAGSAPGLPPPQHGAIPLPDEVKTHSSFWKPFQCPECGKGFSRS
SNLVRHQRTHEEKSYGCVECGKGFTLREYLMKHQRTHLGKRPYVCSECWKTFSQRHHLEV
HQRSHTGEKPYKCGDCWKSFSRRQHLQVHRRTHTGEKPYTCECGKSFSRNANLAVHRRAH
TGEKPYGCQVCGKRFSKGERLVRHQRIHTGEKPYHCPACGRSFNQRSILNRHQKTQHRQE
PLVQ
Download sequence
Identical sequences Q6NSZ9
ENSP00000334800 ENSP00000377708 ENSP00000262941 gi|64368880|ref|NP_660090.2| NP_660090.2.87134 NP_660090.2.92137 XP_005250251.1.92137 XP_011514207.1.92137 XP_011514208.1.92137 XP_011514209.1.92137 XP_016867313.1.92137 ENSP00000334800 ENSP00000377708 9606.ENSP00000334800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]