SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000337056 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000337056
Domain Number 1 Region: 9-162
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.85e-51
Family Ankyrin repeat 0.00000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000337056
Sequence length 166
Comment (Homo sapiens)
Sequence
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALEL
LKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHT
AVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
Download sequence
Identical sequences A0A024R796 H2QFC1 P55273
cath|current|1bi8B00/6-160 cath|current|1bi8D00/6-160 ENSPTRP00000017860 ENSP00000337056 ENSP00000377224 1bi8_B 1bi8_D 1bi8B ENSPTRP00000017860 ENSP00000337056 gi|17981702|ref|NP_524145.1| gi|4502753|ref|NP_001791.1| NP_001791.1.87134 NP_001791.1.92137 NP_524145.1.87134 NP_524145.1.92137 XP_016790488.1.37143 9598.ENSPTRP00000017860 9606.ENSP00000337056 ENSP00000337056 ENSP00000377224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]