SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000341268 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000341268
Domain Number 1 Region: 8-164
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 2.62e-68
Family TRADD, N-terminal domain 0.0000000421
Further Details:      
 
Domain Number 2 Region: 221-305
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000165
Family DEATH domain, DD 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000341268
Sequence length 312
Comment (Homo sapiens)
Sequence
MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQ
MLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRA
GAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPL
QPPVPSLSEVKPPPPPPPAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRG
CRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAED
LLGLTDPNGGLA
Download sequence
Identical sequences K7CAG9 Q15628
NP_001310481.1.87134 NP_001310481.1.92137 NP_003780.1.87134 NP_003780.1.92137 XP_009429270.2.37143 XP_016785506.1.37143 XP_016879304.1.92137 XP_511022.4.37143 9606.ENSP00000341268 ENSP00000341268 ENSP00000341268 ENSP00000341268 gi|13378137|ref|NP_003780.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]