SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000343479 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000343479
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily CAD & PB1 domains 3.04e-24
Family PB1 domain 0.00000432
Further Details:      
 
Domain Number 2 Region: 208-263
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000612
Family ZZ domain 0.0091
Further Details:      
 
Domain Number 3 Region: 918-955
Classification Level Classification E-value
Superfamily UBA-like 0.00000000185
Family UBA domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000343479
Sequence length 966
Comment (Homo sapiens)
Sequence
MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINS
QGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRV
LGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFREQVVNETVEKLEQKLHEK
LVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNIC
EDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHSKYSTPRLPAALEQVRLQKQVDKNFLKA
EKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQSNTLMLP
LQPCTSVMPMLSAAFVDENLPDGTHLQPGTKFIKHWRMKNTGNVKWSADTKLKFMWGNLT
LASTEKKDVLVPCLKAGHVGVVSVEFIAPALEGTYTSHWRLSHKGQQFGPRVWCSIIVDP
FPSEESPDNIEKGMISSSKTDDLTCQQEETFLLAKEERQLGEVTEQTEGTAACIPQKAKN
VASERELYIPSVDLLTAQDLLSFELLDINIVQELERVPHNTPVDVTPCMSPLPHDSPLIE
KPGLGQIEEENEGAGFKALPDSMVSVKRKAENIASVEEAEEDLSGTQFVCETVIRSLTLD
AAPDHNPPCRQKSLQMTFALPEGPLGNEKEEIIHIAEEEAVMEEEEDEEDEEEEDELKDE
VQSQSSASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERGAEGKPGVEAGQEPAEAG
ERLPGGENQPQEHSISDILTTSQTLETVPLIPEVVELPPSLPRSSPCVHHHGSPGVDLPV
TIPEVSSVPDQIRGEPRGSSGLVNSRQKSYDHSRHHHGSSIAGGLVKGALSVAASAYKAL
FAGPPVTAQPIISEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNND
WYSQRY
Download sequence
Identical sequences A0A024R1V3 Q14596
ENSP00000343479 HR5455 gi|14110375|ref|NP_005890.2| gi|14110378|ref|NP_114064.1| gi|14110381|ref|NP_114068.1| NP_005890.2.87134 NP_005890.2.92137 NP_114068.1.87134 NP_114068.1.92137 XP_011523115.1.92137 XP_016880131.1.92137 9606.ENSP00000343479 ENSP00000343479 ENSP00000411250 ENSP00000466667 ENSP00000343479 ENSP00000411250 ENSP00000466667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]