SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000344095 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000344095
Domain Number 1 Region: 330-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.79e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 372-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.5e-16
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000344095
Sequence length 504
Comment (Homo sapiens)
Sequence
MKEESAAQLGCCHRPMALGGTGGSLSPSLDFQLFRGDQVFSACRPLPDMVDAHGPSCASW
LCPLPLAPGRSALLACLQDLDLNLCTPQPAPLGTDLQGLQEDALSMKHEPPGLQASSTDD
KKFTVKYPQNKDKLGKQPERAGEGAPCPAFSSHNSSSPPPLQNRKSPSPLAFCPCPPVNS
ISKELPFLLHAFYPGYPLLLPPPHLFTYGALPSDQCPHLLMLPQDPSYPTMAMPSLLMMV
NELGHPSARWETLLPYPGAFQASGQALPSQARNPGAGAAPTDSPGLERGGMASPAKRVPL
SSQTGTAALPYPLKKKNGKILYECNICGKSFGQLSNLKVHLRVHSGERPFQCALCQKSFT
QLAHLQKHHLVHTGERPHKCSVCHKRFSSSSNLKTHLRLHSGARPFQCSVCRSRFTQHIH
LKLHHRLHAPQPCGLVHTQLPLASLACLAQWHQGALDLMAVASEKHMGYDIDEVKVSSTS
QGKARAVSLSSAGTPLVMGQDQNN
Download sequence
Identical sequences ENSP00000344095 ENSP00000363320 9606.ENSP00000344095 gi|148727315|ref|NP_775845.2| gi|168693669|ref|NP_001108231.1| NP_001108231.1.87134 NP_001108231.1.92137 NP_775845.2.87134 NP_775845.2.92137 ENSP00000344095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]