SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000345229 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000345229
Domain Number 1 Region: 379-510
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 493-618
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000659
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 349-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000779
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 4 Region: 95-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000104
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 5 Region: 46-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000013
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  9606.ENSP00000345229
Domain Number - Region: 318-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000103
Family EGF-type module 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000345229
Sequence length 737
Comment (Homo sapiens)
Sequence
MQPRRAQAPGAQLLPALALLLLLLGAGPRGSSLANPVPAAPLSAPGPCAAQPCRNGGVCT
SRPEPDPQHPAPAGEPGYSCTCPAGISGANCQLVADPCASNPCHHGNCSSSSSSSSDGYL
CICNEGYEGPNCEQALPSLPATGWTESMAPRQLQPVPATQEPDKILPRSQATVTLPTWQP
KTGQKVVEMKWDQVEVIPDIACGNASSNSSAGGRLVSFEVPQNTSVKIRQDATASLILLW
KVTATGFQQCSLIDGRSVTPLQASGGLVLLEEMLALGNNHFIGFVNDSVTKSIVALRLTL
VVKVSTCVPGESHANDLECSGKGKCTTKPSEATFSCTCEEQYVGTFCEEYDACQRKPCQN
NASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDPCRNGATCISSLSGFTCQCPE
GYFGSACEEKVDPCASSPCQNNGTCYVDGVHFTCNCSPGFTGPTCAQLIDFCALSPCAHG
TCRSVGTSYKCLCDPGYHGLYCEEEYNECLSAPCLNAATCRDLVNGYECVCLAEYKGTHC
ELYKDPCANVSCLNGATCDSDGLNGTCICAPGFTGEECDIDINECDSNPCHHGGSCLDQP
NGYNCHCPHGWVGANCEIHLQWKSGHMAESLTNMPRHSLYIIIGALCVAFILMLIILIVG
ICRISRIEYQGSSRPAYEEFYNCRSIDSEFSNAIASIRHARFGKKSRPAMYDVSPIAYED
YSPDDKPLVTLIKTKDL
Download sequence
Identical sequences Q8NFT8
gi|116235485|ref|NP_620711.3| NP_620711.3.87134 NP_620711.3.92137 ENSP00000345229 ENSP00000345229 9606.ENSP00000345229 ENSP00000345229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]