SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000355384 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000355384
Domain Number 1 Region: 478-581
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000373
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000355384
Sequence length 606
Comment (Homo sapiens)
Sequence
MPSSVTALGQARSSGPGMAPSACCCSPAALQRRLPILAWLPSYSLQWLKMDFVAGLSVGL
TAIPQALAYAEVAGLPPQYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTFHEP
AYAVLLAFLSGCIQLAMGVLRLGFLLDFISYPVIKGFTSAAAVTIGFGQIKNLLGLQNIP
RPFFLQVYHTFLRIAETRVGDAVLGLVCMLLLLVLKLMRDHVPPVHPEMPPGVRLSRGLV
WAATTARNALVVSFAALVAYSFEVTGYQPFILTGETAEGLPPVRIPPFSVTTANGTISFT
EMVQDMGAGLAVVPLMGLLESIAVAKAFASQNNYRIDANQELLAIGLTNMLGSLVSSYPV
TGSFGRTAVNAQSGVCTPAGGLVTGVLVLLSLDYLTSLFYYIPKSALAAVIIMAVAPLFD
TKIFRTLWRVKRLDLLPLCVTFLLCFWEVQYGILAGALVSLLMLLHSAARPETKVSEGPV
LVLQPASGLSFPAMEALREEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDFQ
KQGVALAFVGLQVPVLRVLLSADLKGFQYFSTLEEAEKHLRQEPGTQPYNIREDSILDQK
VALLKA
Download sequence
Identical sequences Q86WA9
ENSP00000355384 ENSP00000355384 ENSP00000403998 ENSP00000440724 ENSP00000459470 ENSP00000355384 ENSP00000403998 ENSP00000440724 ENSP00000459470 gi|262206063|ref|NP_001159819.1| gi|262206069|ref|NP_001159820.1| gi|262206075|ref|NP_001159821.1| gi|262206105|ref|NP_775897.3| NP_001159819.1.87134 NP_001159819.1.92137 NP_001159820.1.87134 NP_001159820.1.92137 NP_001159821.1.87134 NP_001159821.1.92137 NP_775897.3.87134 NP_775897.3.92137 9606.ENSP00000355384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]