SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000359085 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000359085
Domain Number 1 Region: 297-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000132
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 2 Region: 364-422
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000203
Family Laminin-type module 0.024
Further Details:      
 
Weak hits

Sequence:  9606.ENSP00000359085
Domain Number - Region: 420-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000275
Family Laminin-type module 0.019
Further Details:      
 
Domain Number - Region: 472-500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000502
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 121-177
Classification Level Classification E-value
Superfamily Sialidases 0.0353
Family Sialidases (neuraminidases) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000359085
Sequence length 539
Comment (Homo sapiens)
Sequence
MYLSRFLSIHALWVTVSSVMQPYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKY
LKVKLDPPDITCGDPPETFCAMGNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQS
ATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYAT
DCLDAFHMDPKSVKDLSQHTVLEIICTEEYSTGYTTNSKIIHFEIKDRFAFFAGPRLRNM
ASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCN
LHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGTANTCIPSISS
IGNCECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIEC
YCNPLGSIHDRCNGSGFCECKTGTTGPKCDECLPGNSWHYGCQPNVCDNELLHCQNGGTC
HNNVRCLCPAAYTGILCEKLRCEEAGSCGSDSGQGAPPHGSPALLLLTTLLGTASPLVF
Download sequence
Identical sequences A0A2J8M4H1 A0A2K5K855 A0A2K5KW05 A0A2K5TR62 A0A2K5Z4U3 A0A2K6N740 G3RJD2 G7MIC2 Q9Y2I2
ENSP00000359085 ENSP00000359090 gi|164414431|ref|NP_001106697.1| ENSP00000359085 ENSP00000359090 ENSP00000359082 9606.ENSP00000359085 ENSPTRP00000052006 ENSPTRP00000052006 NP_001106697.1.87134 NP_001106697.1.92137 XP_007975964.1.81039 XP_008974021.1.60992 XP_010360147.1.97406 XP_011539323.1.92137 XP_011790606.1.43180 XP_011824266.1.47321 XP_011824267.1.47321 XP_011920770.1.92194 XP_011920771.1.92194 XP_011920772.1.92194 XP_015001689.1.72884 XP_015001696.1.72884 XP_016856169.1.92137 XP_016856170.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]