SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000365294 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000365294
Domain Number 1 Region: 176-408
Classification Level Classification E-value
Superfamily RNI-like 2.94e-20
Family 28-residue LRR 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000365294
Sequence length 479
Comment (Homo sapiens)
Sequence
MSFQAPRRLLELAGQSLLRDQALAISVLDELPRELFPRLFVEAFTSRRCEVLKVMVQAWP
FPCLPLGSLMKTPDLEILHYVVDGIDCLLAQKVRPRRWKLQVLEMRDVDENFWTIWSGAR
PLSCSPEAMSKRQTVEDCPRTGEKQPLKVFMDVCLKEKSVDEDLSFFSGWVQHRRRSVHL
CCTKVVNYSMNILNFRNILETVYPDSIQVLEIWNMCWPCMVAEVSRYLSQMKNLRKLFIS
DGCGYLPSFESQGQLVAEFSSVFLRLEYLQMLYMRRIRFFEGYLDQLIRCLKSPLETLAL
TYGSLDEEDLKCLPWYPSLSQLKQLNLSHGTLRFIRLEPLRALLEKVAATLQTLFLVDCG
IGDSKLRVILPALSRCSNLTTFCFHGNDTSMDGLKDLLRHTGRLSNLSLETYPAPRESLD
NRGRVISELLTPLQAELMRILREVREPNRIFFGPVSCPCCGMSPTEQLEFNFCLRGRPA
Download sequence
Identical sequences ENSP00000365294 gi|153791443|ref|NP_001093320.1| 9606.ENSP00000365294 ENSP00000365294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]