SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000366509 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000366509
Domain Number 1 Region: 48-137
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.29e-38
Family SCAN domain 0.0000688
Further Details:      
 
Domain Number 2 Region: 356-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.55e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 402-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-19
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 487-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 318-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 216-264
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000209
Family KRAB domain (Kruppel-associated box) 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000366509
Sequence length 545
Comment (Homo sapiens)
Sequence
MAREPRKNAALDAQSAEDQTGLLTVKVEKEEASALTAEVRAPCSPARGPERSRQRFRGFR
YPEAAGPREALSRLRELCGQWLQPEMHSKEQILELLVLEQFLTILPGNLQSWVREQHPES
GEEVVVLLEYLERQLDEPAPQVPVGDQGQELLCCKMALLTQTQGSQSSQCQPMKALFKHE
SLGSQPLHDRVLQVPGLAQGGCCREDAMVASRLTPGSQGLLKMEDVALTLTPGWTQLDSS
QVNLYRDEKQENHSSLVSLGGEIQTKSRDLPPVKKLPEKEHGKICHLREDIAQIPTHAEA
GEQEGRLQRKQKNAIGSRRHYCHECGKSFAQSSGLTKHRRIHTGEKPYECEDCGKTFIGS
SALVIHQRVHTGEKPYECEECGKVFSHSSNLIKHQRTHTGEKPYECDDCGKTFSQSCSLL
EHHKIHTGEKPYQCNMCGKAFRRNSHLLRHQRIHGDKNVQNPEHGESWESQGRTESQWEN
TEAPVSYKCNECERSFTRNRSLIEHQKIHTGEKPYQCDTCGKGFTRTSYLVQHQRSHVGK
KTLSQ
Download sequence
Identical sequences A0A0S2Z658 Q969J2
gi|17738285|ref|NP_061983.2| ENSP00000366509 ENSP00000366509 9606.ENSP00000366509 NP_061983.2.87134 NP_061983.2.92137 XP_005249152.1.92137 ENSP00000366509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]