SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000376076 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000376076
Domain Number 1 Region: 14-97
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.06e-40
Family Ubiquitin-related 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000376076
Sequence length 101
Comment (Homo sapiens)
Sequence
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMN
SLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
Download sequence
Identical sequences A0A024R3Z2 A0A250XUY8 A0A2I3LR16 A0A2J8WUY8 A0A2K5EBY3 A0A2K5MG21 A0A2K6DP69 A0A2K6EKD7 A0A2K6Q379 A0A2K6U9D7 A7WLH8 B0M1N0 F7HZB5 G3S6X5 H9EMK4 I7G9I8 K7CF70 P63165 P63166 Q5E9D1 Q5I0H3 Q5R6J4
ENSDNOP00000034968 10090.ENSMUSP00000088935 10116.ENSRNOP00000022048 9606.ENSP00000376076 9913.ENSBTAP00000013000 d2n1aa1 gi|4507801|ref|NP_003343.1| gi|54792065|ref|NP_001005781.1| ENSGGOP00000023832 ENSRNOP00000022048 2las_A ENSMUSP00000088935 ENSGGOP00000023832 ENSMUSP00000088935 ENSMUSP00000088935 ENSP00000376076 ENSP00000376077 NP_001005781.1.87134 NP_001005781.1.92137 NP_001009672.1.100692 NP_001009672.1.4139 NP_001030535.1.59421 NP_001030535.1.76553 NP_001106146.1.46622 NP_001126532.1.23681 NP_001182571.1.72884 NP_001271750.1.63531 NP_003343.1.87134 NP_003343.1.92137 NP_033486.1.92730 XP_002712582.1.1745 XP_002749693.1.60252 XP_003820811.1.60992 XP_003925692.1.74449 XP_004033110.1.27298 XP_004378290.1.4749 XP_004378291.1.4749 XP_004458932.1.11602 XP_005574017.1.63531 XP_005676437.1.57651 XP_005904315.1.15283 XP_006189994.1.101512 XP_006205253.1.17985 XP_006862039.1.41390 XP_006889152.1.29581 XP_006921425.1.64745 XP_007933252.1.48129 XP_007964074.1.81039 XP_008833671.1.79516 XP_010385198.1.97406 XP_010859285.1.44457 XP_010970139.1.22495 XP_010990036.1.51371 XP_011367443.1.92234 XP_011716342.1.29376 XP_011829870.1.47321 XP_011902949.1.92194 XP_012007474.1.54773 XP_012301741.1.9421 XP_012329628.1.9421 XP_012380470.1.11602 XP_012510834.1.63892 XP_012594421.1.48125 XP_014640231.1.5094 XP_014948977.1.66739 XP_014966121.1.72884 XP_014966122.1.72884 XP_015336760.1.40921 XP_016017443.1.101085 XP_016064343.1.3490 XP_017506335.1.32401 XP_017506336.1.32401 XP_019061880.1.5607 XP_019830757.1.53367 XP_020015380.1.5219 XP_020746577.1.74333 XP_020759375.1.74333 XP_021510043.1.76796 XP_516035.1.37143 ENSRNOP00000022048 ENSP00000376076 ENSP00000376077 Hs4507801___KOG1769 ENSBTAP00000013000 ENSCJAP00000009094 ENSCJAP00000042454 ENSPANP00000002796 ENSBTAP00000013000 HT89 SUMO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]