SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000376445 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000376445
Domain Number 1 Region: 77-208
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.22e-21
Family Toll/Interleukin receptor TIR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000376445
Sequence length 235
Comment (Homo sapiens)
Sequence
MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPS
LSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQL
RDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLS
GLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRCKLLQEGEGERDSATVSDLL
Download sequence
Identical sequences K7CIJ8
ENSP00000376445 ENSP00000376446 NP_001305705.1.87134 NP_001305705.1.92137 NP_683708.1.87134 NP_683708.1.92137 XP_005271456.2.92137 XP_014202481.1.60992 XP_016775343.1.37143 XP_016775344.1.37143 XP_016775345.1.37143 XP_016775346.1.37143 XP_016775347.1.37143 gi|22547219|ref|NP_683708.1| ENSP00000376445 9606.ENSP00000376445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]