SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000386896 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000386896
Domain Number 1 Region: 24-466
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 4.84e-73
Family Integrin alpha N-terminal domain 0.00000196
Further Details:      
 
Domain Number 2 Region: 794-1018
Classification Level Classification E-value
Superfamily Integrin domains 1.15e-54
Family Integrin domains 0.00056
Further Details:      
 
Domain Number 3 Region: 466-628
Classification Level Classification E-value
Superfamily Integrin domains 8.37e-33
Family Integrin domains 0.0008
Further Details:      
 
Domain Number 4 Region: 629-791
Classification Level Classification E-value
Superfamily Integrin domains 1.73e-27
Family Integrin domains 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000386896
Sequence length 1091
Comment (Homo sapiens)
Sequence
MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETEHDESLVPVPANSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSAH
LLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYMNQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDDLGKVFIYHGSANGINTK
PTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNR
IDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFR
NQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSL
PEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKG
VPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSNVTFYLVLSTTEVTFDTPDLDINLKLETTSNQD
NLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLG
KPLTNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKVTCEPQKEINSLNLTESHNSRK
KREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNST
FLEEYSKLNYLDILMRAFIDVTAAAENIRLPNAGTQVRVTVFPSKTVAQYSGVPWWIILV
AILAGILMLALLVFILWKCGFFKRSRYDDSVPRYHAVRIRKEEREIKDEKYIDNLEKKQW
ITKWNENESYS
Download sequence
Identical sequences G3QXU3
ENSP00000386896 gi|119395740|ref|NP_001073286.1| ENSP00000386896 NP_001073286.1.87134 NP_001073286.1.92137 XP_004032841.1.27298 9606.ENSP00000386896 NYSGRC-119395740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]