SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000388531 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000388531
Domain Number 1 Region: 50-177
Classification Level Classification E-value
Superfamily RNI-like 0.000000000022
Family Cyclin A/CDK2-associated p19, Skp2 0.041
Further Details:      
 
Domain Number 2 Region: 2-38
Classification Level Classification E-value
Superfamily F-box domain 0.000000011
Family F-box domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000388531
Sequence length 180
Comment (Homo sapiens)
Sequence
MAESLPLEMLTYILSFLPLSDQKEASLVSWAWYRAAQNALRESLGLRGICCISLTNLDGS
LASHQVLQSVAYHLGPHLQSLSLGGGSPTEASSVALILGCPALCVLDLSGCNSLFTSGTL
LAQPEMAQSVQQALSGLRELNLAGLRDLADLSFNQLSSCAPSLERLSLAYCHLTFELGPA
Download sequence
Identical sequences B4DNW2
ENSP00000388531 9606.ENSP00000388531 ENSP00000388531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]