SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000389657 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000389657
Domain Number 1 Region: 214-311
Classification Level Classification E-value
Superfamily HMG-box 1.57e-21
Family HMG-box 0.0000349
Further Details:      
 
Domain Number 2 Region: 92-173
Classification Level Classification E-value
Superfamily HMG-box 2.49e-19
Family HMG-box 0.0000423
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000389657
Sequence length 393
Comment (Homo sapiens)
Sequence
MALPRSQGHWSNKDILRLLECMENNRPSDDNSTFSSTQSHMDWGKVAFKNFSGEMCRLKW
LEISCNLRKFGTLKELVLEAKKCVKKMNKSQKYRNGPDFPKRPLTAYNRFFKESWPQYSQ
MYPGMRSQELTKILSKKYRELPEQMKQKYIQDFRKEKQEFEEKLARFREEHPDLVQKAKK
SSVSKRTQNKVQKKFQKNIEEVRSLPKTDRFFKKVKFHGEPQKPPMNGYHKFHQDSWSSK
EMQHLSVRERMVEIGRRWQRIPQSQKDHFKSQAEELQKQYKVKLDLWLKTLSPENYAAYK
ESTYAKGKNMAMTGGPDPRLKQADPQSSSAKGLQEGFGEGQGLQAAGTDSSQTIWVNCHV
SMEPEENRKKDREKEESSNSSDCSSGEEIEVDV
Download sequence
Identical sequences P0CB47
9606.ENSP00000389657 gi|221136785|ref|NP_001137447.1| NP_001137447.1.87134 NP_001137447.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]