SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000398416 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000398416
Domain Number 1 Region: 13-76
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.00000000000000791
Family beta-Galactosidase/glucuronidase domain 0.0000734
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000398416
Sequence length 119
Comment (Homo sapiens)
Sequence
MSLPKPWSLLPPAGLVNYQISVKCSNQFKLEVCLLNAENKVVDNQAGTQGQLKVLGANLW
WPYLMHEHPAYLYSWEDGDCSHQSLGPLPACDLCDQLHLRSRQGGEPGGPHPISPCLCL
Download sequence
Identical sequences ENSGGOP00000022359 PGOCHP00000173656 9606.ENSP00000381977 9606.ENSP00000398416 ENSGGOP00000022359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]