SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000405154 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000405154
Domain Number 1 Region: 59-118
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.94e-25
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 367-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 535-592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 423-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.75e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-20
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 6 Region: 577-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.51e-20
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 7 Region: 493-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.77e-20
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 8 Region: 245-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.14e-16
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 9 Region: 330-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000235
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000405154
Sequence length 666
Comment (Homo sapiens)
Sequence
MQEVVLLDESSGPPSQLLWTRQDTQLPQESALLPAPYPAFTKDGSQGNLPQADITLMSQA
QESVTFEDVAVNFTNREWQCLTYAQRHLYKDVMLENYGNMVSLGFPFPKPPLISHLEREV
DPCVQDPQDRESLSCSYPVSADKMWPENEKASSQQEIFENGEAYWMKFNSLLKVDSRDPK
VREVCVQDVKLENQWETSIREKLREEKEGSEEVTCKKGKNQKVLSKNLNPNSKHSQCNKV
LIAQKLHECARCGKNFSWHSDLILHEQIHSGEKPHVCNECGKAFKTRNQLSMHRIIHTGE
KPFNCTQCGKAFNSRSALCRHKKTHSGEKPHECRDCGKAFKTRNRLCMHQLIHTGEKPYK
CNCCGKAFQFKHSLTIHGRIHTGEKPYECEECGKAFSGSSDLTKHIRIHTGERPYECSKC
GRAFSRSSDLSKHKRIHTREKHYGCPQCGKDFSIKAELTKHRRIHTEEKRYRCEECGKAF
RHNCKRRAHEREHTGEKPYQCRDCGKTFQDKHCLTIHQRIHTGEKPYKCLECGKAFSGKS
NLTNHRRIHTGEKPHKCEVCGMAFHHSSVLRQHKRIHTGEKPYTCSECGTSFRQGSALIG
HKRVHTGEKPYECEECGKAFRVSSNLTGHKKRKHQVWSTHELDGSRKSLSPVTVSQTSVV
SILTSA
Download sequence
Identical sequences A0A1U9X8W3 Q5JNZ3
NP_001010877.2.87134 NP_001010877.2.92137 XP_016866247.1.92137 XP_016866248.1.92137 gi|72384335|ref|NP_001010877.2| 9606.ENSP00000366384 9606.ENSP00000373151 9606.ENSP00000398983 9606.ENSP00000399157 9606.ENSP00000405154 9606.ENSP00000415772 ENSP00000366384 ENSP00000373151 ENSP00000398983 ENSP00000399157 ENSP00000405154 ENSP00000415772 ENSP00000366384 ENSP00000373151 ENSP00000398983 ENSP00000399157 ENSP00000405154 ENSP00000415772 ENSP00000366384 ENSP00000373151 ENSP00000398983 ENSP00000399157 ENSP00000405154 ENSP00000415772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]