SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000414869 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000414869
Domain Number 1 Region: 72-315
Classification Level Classification E-value
Superfamily RNI-like 3.34e-23
Family 28-residue LRR 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000414869
Sequence length 381
Comment (Homo sapiens)
Sequence
XRWKLQVLDLQDVCENFWMVWSEAMARGCFLNAKRNKKPVQDCPRMRGRQPLTVFVELWL
KNRTLDEHLTCLLLWVKQRKDLLHLCCKKLKILGMPFRNIRSILKMVNLDCIQEVEVNCK
WVLPILTQFTPYLGHMRNLQKLVLSHMDVSRYVSPEQKKEIVTQFTTQFLKLHCLQKLYM
NSVSFLEGHLDQLLSCLKTSLKVLTITNCVLLESDLKHLSQCPSISQLKTLDLSGIRLTN
YSLVPLQILLEKVAATLEYLDLDDCGIIDSQVNAILPALSRCFELNTFSFCGNPISMATL
ENLLSHTIILKNLCLELYPAPRESYGADGTLCWSRFTQIRAELMKRVRDLRHPKRILFGT
DYCPDCGNRSFYDLEADQYCC
Download sequence
Identical sequences ENSP00000414869 9606.ENSP00000414869 ENSP00000414869 ENSP00000414869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]