SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9615.ENSCAFP00000001969 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9615.ENSCAFP00000001969
Domain Number 1 Region: 37-503
Classification Level Classification E-value
Superfamily Sema domain 1.96e-131
Family Sema domain 0.0000174
Further Details:      
 
Domain Number 2 Region: 1348-1475,1671-1860
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.88e-51
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 948-1035
Classification Level Classification E-value
Superfamily E set domains 1.98e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.053
Further Details:      
 
Domain Number 4 Region: 854-948
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000026
Family Other IPT/TIG domains 0.006
Further Details:      
 
Domain Number 5 Region: 1033-1137
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000216
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.055
Further Details:      
 
Domain Number 6 Region: 506-558
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000798
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 7 Region: 1134-1223
Classification Level Classification E-value
Superfamily E set domains 0.0000014
Family E-set domains of sugar-utilizing enzymes 0.084
Further Details:      
 
Domain Number 8 Region: 805-837
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000406
Family Plexin repeat 0.0025
Further Details:      
 
Weak hits

Sequence:  9615.ENSCAFP00000001969
Domain Number - Region: 650-682
Classification Level Classification E-value
Superfamily Plexin repeat 0.0523
Family Plexin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9615.ENSCAFP00000001969
Sequence length 1890
Comment (Canis familiaris)
Sequence
MPWNWTCFLSHLLMVGMGSSTLLPRQPAPLSQKRSFVTFRGEPAEGFNHLVVDERTGHIY
LGAVNRIYKLSSDLKVLVTHQTGPDEDNPKCYPPRIVQTCNEPLTTTNNVNKMLLIDYKE
NRLIACGSLYQGICKLLRLEDLFKLGEPFHKKEHYLSGVNESGSVFGVIVSYSNLDDKLF
IATAVDGKPEYFPTISSRRLTKNSEADGMFAYVFHDEFVASMIKIPSDTFTVIPDFDIYY
VYGFSSGNFVYFLTLQPEMVSPPGSTTKEQVYTSKLVRLCKEDTAFNSYVEVPIGCERSG
VEYRLLQAAYLSKAGAVLAQTLGVRPEDDLLFTVFSKGQKRKMKSLDESALCIFILKQIN
DRIKERLQSCYRGEGTLDLAWLKVKDIPCSSALLTIDDNFCGLDMNAPLGVSEMVRGIPV
FTEDRDRMTSVIAYVYKNHSLAFVGTKSGKLKKIRVDGPRGNALQYETVQVVDPGPVLRD
MAFSKDHEQLYIMSERQLTRVPVESCSQYRSCSECLGSGDPHCGWCVLHNTCTRKERCER
SREPRRFASEMKQCVRLTVHPSNISVSQYNVLLVLETYNVPELSAGVNCTFEDLSEMDGL
VVGNQIQCYSPAAKEVPRIITENGDHHVVQLQLKSKETGMTFASTSFVFYNCSVHNSCLS
CVESPYRCHWCKYRHVCTHDPKTCSFQEGRVKVPEDCPQLLRVDKILVPVEVIKPITLKA
KNLPQPQSGQRGYECVLSIQGNEQRVPALRFNSSSVQCQNTSYSYEGMEINNLPVELTVV
WNGHFNIDNPAQNKVHLYKCGAMRESCGLCLKADPDFQCGWCQSQGQCTLRQHCPVHESQ
WLELSGANSRCTNPRITEIIPVTGPREGGTKVTIRGENLGLEFRDIASHVKVAGVECSPL
VDGYIPAEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLSDLKPKRG
PMSGGTQVTITGTNLNAGSNVVVMFGKQPCLFHRRSPSYIICNTTSSDEVLEMKVMVQVD
KASIHQDLFFQYVEDPTIVRIEPEWSIVSGNTPIAVWGTHLDLIQNPQIRAKHGGKEHIN
LCEVLNATEMTCQAPALALGPDHQSDLTERPEEFGFILDNVQSLLILNKTNFTYYPNPVF
EAFGPSGILELKPGTPIILKGKNLIPPVAGGNVKLNYTVLVGEKPCTVTVSDVQLLCESP
NLIGRHKVMARVGGMEYSPGMVYVAPDSPLSLPAIVSIAVAGGLLVIFIVAVLIAYKRKS
RESDLTLKRLQMQMDNLESRVALECKEAFAELQTDIHELTSDLDGAGIPFLDYRTYTMRV
LFPGIEDHPVLRDLEVPGYRQERVEKGLKLFAQLINNKVFLLSFIRTLESQRSFSMRDRG
NVASLIMTVLQSKLEYATDVLKQLLADLIDKNLESKNHPKLLLRRTESVAEKMLTNWFTF
LLYKFLKECAGEPLFSLFCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLVLSC
VNPDNANSPEVPVKILNCDTITQVKEKILDAIFKNVPCSHRPKAADMDLEWRQGSGARMI
LQDEDITTKIENDWKRLNTLAHYQVPDGSVVALVSKQVTAYNAVNNSTVSRTSASKYENM
IRYTGSPDSLRSRTPMITPDLESGVKMWHLVKNHEHGDQKEGDRGSKMVSEIYLTRLLAT
KGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHGIHDPHVRHTWKSNCLP
LRFWVNMIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDI
PSYKNWVERYYSDIGKMPAISDQDMNAYLAEQSRMHMNEFNAMSALSEIFSYVGKYSEEI
LGPLDHDDQCGKQKLAYKLEQVITLMSLDS
Download sequence
Identical sequences 9615.ENSCAFP00000001969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]