SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9615.ENSCAFP00000006751 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9615.ENSCAFP00000006751
Domain Number 1 Region: 944-1169
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.41e-36
Family DBL homology domain (DH-domain) 0.0023
Further Details:      
 
Domain Number 2 Region: 1325-1526
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-33
Family Pleckstrin-homology domain (PH domain) 0.0000886
Further Details:      
 
Domain Number 3 Region: 1156-1273
Classification Level Classification E-value
Superfamily PH domain-like 1.7e-23
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Weak hits

Sequence:  9615.ENSCAFP00000006751
Domain Number - Region: 873-903,984-1011
Classification Level Classification E-value
Superfamily EF-hand 0.0178
Family Calbindin D9K 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9615.ENSCAFP00000006751
Sequence length 1528
Comment (Canis familiaris)
Sequence
STSTREETFWKYPCWKFHPLDSPKPPVAPKPKTTSPLTPMTTPKFTSSPRPDSLHSPNSM
SRGPKPPIAPKPRLSTPSEWRASVYVINSLNKCSNGKLLCVDRGLYEEHRSNLECSESEA
DEDYIVVPKAPPKEDEPRDSTSAENAVMISPAAGEEECQEGGEESDPEGMGAAEDLAAPA
EGVISDEADGGTAPTPEDVGVEDSACDLGAEEQTFTREEEEKLVEEHNMYNLEDGGPWDG
EAILPSDVILTQVDLEGPAIPSEEPGPPGTPREEGEGGEEGSPNTELGAPDECVGSDRPP
EGDAEDASKELTKNEGLASSIQEAERAIVNPEVSKEECEDTIASGDQDEPPDQNEKTDQE
EMAAVTQEVGEDPREGRDPVQDEPAEESCQIIPFENDGVDDFVTSLSGSPYEFFPTESTS
FCSESYSSLSKSAGGLESQQEPQSAECAEQDPIVRASYGAGEGPSVPDVVVMTGDEDAGD
DALTNPYEMGVDLDQGTVPGEGEEPETQAASDTLSAYGTKEEMNSDAEGGLVPTDRKNII
ARARPHSGKVAGYVPETVPEEIGPEAGSSAIGIKGATKEARKTVLSLEGKPLEASRALPA
KPRAFTLYPRSFSVEGREIPVSLYRESEASSLDDHRIKRKDDNLSLPCVIGSSGSFSQRN
HLPSSGTSTPSSVVDIPPPFDLACITKKPITKSSPSLLIETEPPDKYTKKKKSSFKKFLA
LTFKKKSENKVHVDVNVSSSRSSSESSYHGPARLLEIDRRSLSNSPQLKARTGKLRASES
PSSLIFYRDGKRKGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPNADTSDYENIP
AMNSDYENIQIPPRRPARAGTFTKLFEDQSRALSTANENDGYVDMSSFNAFESKQQSTDQ
EAESAYTEPYKVCPISAAAPKEDLSSDEEQGSSEEEDSVLRDPSLTHKMEGQSRAHVIAQ
ELLSSEKAYVEMLQHLHLDFHGAVTRALDEIDQEGKDTLSREELRRGLSELPAIRDLHQG
ILEELGERLLHCCREGQQKVADVFLAREQEFDHHAAHILQFDRYLSLLSETCLHSPRLAA
AVREFEEQQSQQGGGQNVKHRLLRVVQRLFQYQVLLTDYLNNLCPDSAEYDNTQGALTLI
SKVTDRANDSMEQGENLQKLVHIEHSVRGQGDLLQPGREFLKEGTLMKVTGKSRRPRHLF
LMSDVLLYTYPQKDGKYRLKNTLSVASMKVSRPVMEKVPYALKIETPQSCLTLSASSCAE
RDEWHSCLSRALPEDYKAQALAAFHHSVEIRERLGVSLGERPPTLVPVTHVMMCMNCGCD
FSLTLRRHHCHACGKIVCRNCSRNKYPLKYLKDRMAKVCDGCYGELKKRGGDVPGLMRER
PVSMSFPLSSPRFSSSAFSSVFHSINPSTFKKQKKVPSALTEVAASGEGSAISGYLSRCK
KGKRHWKKLWFVIKGKVLYTYMASEDTVAMESMPLLGFTIAPEKEEGSSEVGPIFHLYHK
KTLFYSFKAEDTNSAQRWIEAMEDASVL
Download sequence
Identical sequences 9615.ENSCAFP00000006751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]