SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9615.ENSCAFP00000009476 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9615.ENSCAFP00000009476
Domain Number 1 Region: 859-1070
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-55
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 1233-1419
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-26
Family Pleckstrin-homology domain (PH domain) 0.00000889
Further Details:      
 
Domain Number 3 Region: 1059-1179
Classification Level Classification E-value
Superfamily PH domain-like 4.78e-25
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9615.ENSCAFP00000009476
Sequence length 1423
Comment (Canis familiaris)
Sequence
FFSFLEIKKPPVAPKPKFVVANKPAPPPVAPKPDIVISGVPQPTKKTKPAIAPKPKVLKG
SSVRDIGQSPSRKIIVNLEEHKQELPENADNSNCKNVGHQSSDYILPVCSCNSQCIHKLG
NRESLFGKQLILEPLEMHENLENSKIDESSSAIKTRSKCDSNVENIKTQTGVVLKANILE
EKLKDVLTQRTSPFISLQKHRSTDNPEMNDGYNSNRQFRIEFADLSPSLSSFEKVPDHHR
CHLQLPNDETYQHTSEKSNTCFHSSEQETLENDGKRSTFLPSGGVSKKSEVKDLGPLEIH
LVPYTPKFPTPKPRKTRAARLLRQKYIDVPSESTEEPGNLDSNSSCLLDAALKNNKISIL
HQNVLCNQERVDKVKPGNKGELNVDSNGDRQHLVNPQKAMHHETSSFEKMETDSNLCSDS
KTVDGSSMSLAVDKGTNFIRCSTLSMSLPKQLKLTCNEHLPTTCNLGVSASQMQKESTIK
GESSSRIVPKKPQRHSLPAAGVLKKAASEELVEKSSYPSNEENNSEKGLERNHLQHLCAQ
NLNMSSSFDMPKRASEKPVWKLPHPILPFSGNPESLKSVTISSNSELSTAMTKPRAKSLS
AMDAERCTKPCKDTQKKNSLKKLLNMKLSICFMKSDFQKFWFKNSQLGDTTTGSLSGGEK
KGIESDWHGMLVEEKRSKPIKAYSADNYSLESQKKRKSRGHTSAANGPRAESLDDQMLSR
ESSSQGPCKSTTSGCAPEYENVRHYEEIPEYENLPFIMAIGKTPELERQNSRSMEDNDAN
VYEVEEPYEAPDGQLQLGPRHQHSSSSGASQEGHNDLGLGLGELPSDEEEDINSSDEDDV
SSDSSKGDPDLGDKQDEDTGMKSKVHHIAKEIMSSEKVFVDVLKLLHIDFRDAVAHASRQ
LGKPVIEDRILNQILYYLPQLYELNRDLLKELEERMSNWTEQHRIADIFVKKGPYLKMYS
TYIKEFDKNIALLDEQCKKNPAFAAVVRDFEMSPRCANLALKHYLLKPVQRIPQYRLLLT
DYLKNLLEDSGDYRDTQDALAVVIEVANHANDTMKQGDNFQKLMQIQYSLNGHHEIVQPG
RVFLKEGTLMKLSRKVMQPRVFFLFNDALLYTTPVQSGMYKLNNMLSLAGMKVRKPTQEA
YQNELKIESVERSFILSASSATERDEWLEAISRSIEEYAKKRITFCPSRSLDEADSENKE
EVSPLGSKAPIWIPDTRATMCMICTSEFTLTWRRHHCRACGKIVCQACSSNKYGLDYLKN
QPARVCEHCFQELQKLDHQHSPKIGSPGNHKSPSSTLSSVLHSIPSGRKQKKIPAALKEV
SANTEDSSMSGYLYRSKGNKKPWKHLWFVIKNKVLYTYAASEDVAALESQPLLGFTVTQV
KDENSESRVFQLLHKNMLFYVFKADDAHSAQKWIEAFQEGTIL
Download sequence
Identical sequences F1Q280
ENSCAFP00000009476 9615.ENSCAFP00000009476 ENSCAFP00000009476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]