SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9615.ENSCAFP00000011788 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9615.ENSCAFP00000011788
Domain Number 1 Region: 222-489
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-76
Family Protein kinases, catalytic subunit 0.00000000292
Further Details:      
 
Domain Number 2 Region: 114-256
Classification Level Classification E-value
Superfamily SH2 domain 3.7e-37
Family SH2 domain 0.00000225
Further Details:      
 
Domain Number 3 Region: 54-138
Classification Level Classification E-value
Superfamily SH3-domain 5.21e-21
Family SH3-domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9615.ENSCAFP00000011788
Sequence length 500
Comment (Canis familiaris)
Sequence
MGVGSSKKQVKEKEKGQWSPVKVSTQSKDPPPLPPLILFNHLTPAPPDACLDQEERFVVA
LYDYSSVNDRDLQMLKGEKLQILKEAGDWWWARSLITGREGYVPSNFVTRVETLEVEKWF
FRSISRKDAERQLLAPVNKAGSFLIRESETNKGAFSLTVKDVTTQGEMIKHYKIRSLDEG
GYYISPRITFPTLQALVQHYSQKGDGLCQRLTQPCVSLAPQNPWAQDEWEIPRQSLKLVR
KLGSGQFGEVWMGYYKNNVKVAIKTLKEGTMSPEAFLGEANLMKTLQHERLVRLYAVVTK
EPIYIVTEYMARGCLLDFLKTVEGSRLSLPRLIDMSAQIAEGMAYIEQMNSIHRDLRAAN
ILVSETLCCKIADFGLARIIDSEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWSFGILL
MEIVTYGRVPYPGMSNPEVIRSLERGYRMPRPDSCPPELYHGVIAECWRSRPEERPTFEF
LQSVLEDFHTATEQQYELQP
Download sequence
Identical sequences E2R5S6
ENSCAFP00000011788 9615.ENSCAFP00000011788 XP_543206.2.84170 ENSCAFP00000011788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]