SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9615.ENSCAFP00000011827 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9615.ENSCAFP00000011827
Domain Number 1 Region: 68-109
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000222
Family Somatomedin B domain 0.0048
Further Details:      
 
Domain Number 2 Region: 107-154
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000051
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9615.ENSCAFP00000011827
Sequence length 297
Comment (Canis familiaris)
Sequence
VCGRRGLRAPRSAGGEVCGRRGLRAARSAGAESMRTLWMALCALARLWPGSLAGCADAGR
CCPGRDAACSARGWRLDRVYGTCYCDQACRRTGDCCFDYARACPARPCIVGEWSPWSGCG
DQCRPAALVRRRPVQQEPRNGGAPCPPLEERAGCLDYSTPRGQDCGRAFVPAFITTSAFN
KERTRQAASPQWSTDTEDAGYCMEFKTESLTHHCALENRPLTRWMQYLREGYTVCVDCQR
PAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI
Download sequence
Identical sequences 9615.ENSCAFP00000011827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]