SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9615.ENSCAFP00000013863 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9615.ENSCAFP00000013863
Domain Number 1 Region: 126-374
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.05e-69
Family Nuclear receptor ligand-binding domain 0.00000000136
Further Details:      
 
Domain Number 2 Region: 57-140
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-30
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9615.ENSCAFP00000013863
Sequence length 474
Comment (Canis familiaris)
Sequence
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGANLNAPNSLGVSALC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC
FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSQQITSPVSGINGDIRAKK
IASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFK
DVLLLGNDYIVPRHCPELAEMSRVSMRILDELVLPFQELQIDDNEYACLKAIIFFDPDAK
GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL
FGMAKIDNLLQEMLLGGSSSDAPHAHHPLHPHLMQEHMGTNVIVANTMPSHLSNGQMCEW
PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAIATIVKPPSAIPQPTITKQEVI
Download sequence
Identical sequences E2R9S0
ENSCAFP00000013863 ENSCAFP00000013863 XP_852731.1.84170 9615.ENSCAFP00000013863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]