SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9615.ENSCAFP00000015480 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9615.ENSCAFP00000015480
Domain Number 1 Region: 46-320
Classification Level Classification E-value
Superfamily L domain-like 7.6e-56
Family Ngr ectodomain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 242-480
Classification Level Classification E-value
Superfamily L domain-like 5.27e-43
Family Ngr ectodomain-like 0.0045
Further Details:      
 
Domain Number 3 Region: 545-844
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 3.39e-28
Family Rhodopsin-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9615.ENSCAFP00000015480
Sequence length 965
Comment (Canis familiaris)
Sequence
MRSPAGLGALWLCAALCASPPAGAPQPRAAPACPAPCRCQEDGIMLSADCSELGLSAVPR
DLDPLTAYLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGHAFSGLYSLKILMLQ
NNQLGGVPADALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVRAL
NNLPALQAMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQHLGTHSFEGLHNLETLDLN
YNELQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHFYDNPIQCVGRSAFQ
DLPKLHTLSLNGATDIQEFPDLKGTTSLEILTLTRAGIRLLPPGMCQQLPRLRVLELSHN
QIEELPSLHRCQKLEEIGLQHNRIGAIGADTFSQLSSLRALDLSWNAIRSIHPEAFVTLR
SLVKLDLTDNQLSTLPLAGLGGLMHLKLRGNLALSQAFSKDSFPKLRILEVPYAYQCCAY
GVCAGFFKSSGQWGAEDFHPAEDEAPKRPPGLLAGQAENHYDLDLDELQLDTEDTRPRPS
VQCSPAPGPFKPCEHLFESWGVRLAVWAIVLLSVLCNGLLLLSVFAGGPGPLPPVKFVVG
AIAGANAVSGLSCGLLASVDALTFGQFAQYGARWETGLGCRATGFLAVLGSEASVLLLTL
AAVQCSVAVSCIRAYGKAPALSSVRAGALGCLLLAGLAAALPLTSVGEYGASPLCLPYAP
PEGRPAALGFAVALVMMNCLCFLLVAAAYIKLYCDLPRADLEAVWDCAMVRHVAWLIFAD
GLLYCPVAFLSFASMLGLFPVTPEAVKSVLLVVLPLPACLNPLLYLLFNPHFRDDLRRLW
PCAGTPGPLAYAAASELEKSSCDSTQALVAFSDVDLILDTSEAGRPPGLEPYGFPSVTLL
SGQQPGGPRSEGSHFAEPEGAHFGSPPASVDGELRLRAEGATPAGGGSSAGRALQPAGPA
FASHL
Download sequence
Identical sequences E2RGS8
ENSCAFP00000015480 ENSCAFP00000015480 9615.ENSCAFP00000015480 XP_848875.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]