SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9615.ENSCAFP00000017423 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9615.ENSCAFP00000017423
Domain Number 1 Region: 954-1083,1279-1467
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.28e-51
Family p120GAP domain-like 0.037
Further Details:      
 
Domain Number 2 Region: 3-112
Classification Level Classification E-value
Superfamily Sema domain 3.01e-24
Family Sema domain 0.0075
Further Details:      
 
Domain Number 3 Region: 555-644
Classification Level Classification E-value
Superfamily E set domains 8.64e-19
Family Other IPT/TIG domains 0.086
Further Details:      
 
Domain Number 4 Region: 643-746
Classification Level Classification E-value
Superfamily E set domains 3.31e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.052
Further Details:      
 
Domain Number 5 Region: 459-556
Classification Level Classification E-value
Superfamily E set domains 0.0000000000014
Family Other IPT/TIG domains 0.015
Further Details:      
 
Domain Number 6 Region: 115-166
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000249
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 7 Region: 743-824
Classification Level Classification E-value
Superfamily E set domains 0.0000000602
Family E-set domains of sugar-utilizing enzymes 0.044
Further Details:      
 
Domain Number 8 Region: 411-445
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000131
Family Plexin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9615.ENSCAFP00000017423
Sequence length 1498
Comment (Canis familiaris)
Sequence
PVPIDDNFCGLDINQPLGGSTPVEGLTLYTTSRDRMTSVASYVYNGYSVVFVGTKSGKLK
KIRADGPPHGGVQYEMVSVLKDGSPILRDMAFSIDQRYLYIMSERQITRVPVESCEQYTT
CGECLSSGDPHCGWCALHNMCSRRDKCQRAWEPNRFAASISQCMSLEVHPSSISVSEHSR
RLSLVVSDAPDLSVGISCAFGNLTEVEGQVSGSQVICISPGPKDVPVIPLDQDWFGLELQ
LRSKETGKIFVSTEFKFYNCSAHQLCLSCVNSAFRCHWCKYRNLCTHDPTTCSFQEGRIN
ISEDCPQLVPTEEILIPVGEVKPITLKARNLPQPQSGQRGYECVLNIQGAVHRVPALRFN
SSSVQCQNSSYQYDGMDISNLAVDFAVVWNGNFIIDNPQDLKVHLYKCAAQRESCGLCLK
ADRKFECGWCSGERRCTLQQHCVSPSSPWLDWSSHNVKCSNPQITEILTVSGPPEGGTRV
TIHGVNLGLDFSEIAHHVQVAGVPCTPLPGDYIIAEQIVCEMGHALVGTTSGPVRLCIGE
CKPEFMTKSHQQYTFVNPSVLSLNPIRGPESGGTMVTITGHYLGAGSSVAVYLGNQTCEF
YGRSMNEIVCVSPPSSNGLGPVPVSVSVDRARVDNNLQFEYIDDPRVQRIEPEWSIASGH
TPLTITGFNLDVIQEPRVRVKFNGKESVNVCKVVNTTTLTCLAPSLTTDYRPGLDTVERP
DEFGFVFNNVQSLLIYNDTKFIYYPNPTFELLSPTGVLDQKPGSPIILKGKNLCPPASGG
AKLNYTVLIGETPCAVTVSETQLLCEPPNLTGQHKVMVHVGGMVFSPGSVSVISDSLLTL
PAIVSIAAGGSLLLIIVIIVLIAYKRKSRENDLTLKRLQMQMDNLESRVALECKEAFAEL
QTDINELTSDLDRSGIPYLDYRTYAMRVLFPGIEDHPVLRELEVQGNGQQHVEKALKLFA
QLINNKVFLLTFIRTLELQRSFSMRDRGNVASLIMTGLQGRLEYATDVLKQLLSDLIEKN
LENKNHPKLLLRRTESVAEKMLTNWFAFLLHKFLKECAGEPLFMLYCAIKQQMEKGPIDA
ITGEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAI
YKNVPYSQRPRAVDMDLEWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVA
LVPKQTSSYNIPASASISRTSISRYDSSFRYTGSPDSLRSRAPMITPDLESGVKVWHLVK
NHDHGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETLFSTVHRGSALPLAIKYM
FDFLDEQADRHSIHDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQ
TFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQ
SRLHAVEFNMLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAMSIES
Download sequence
Identical sequences 9615.ENSCAFP00000017423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]