SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9615.ENSCAFP00000020784 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9615.ENSCAFP00000020784
Domain Number 1 Region: 231-486
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.47e-62
Family Eukaryotic proteases 0.000000223
Further Details:      
 
Domain Number 2 Region: 50-167
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-23
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Weak hits

Sequence:  9615.ENSCAFP00000020784
Domain Number - Region: 197-239
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000618
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9615.ENSCAFP00000020784
Sequence length 490
Comment (Canis familiaris)
Sequence
MSSSRCLVSQLGNDLWRSPQSTGCPGKMWWLLLWGVFQACPTQGSVLLAQQLPQQLTSPG
YPEPYRKGQESSTDIEAPDGFAVRLVFQDFDLEPSQDCEQDSVTITASGMDPSRFCGQQG
SSLGSPPGQREFVSPGNRLRLTFRAPASSRDRTTGLHKGFLALYQAVEVSTPMEASGASK
AISTRGDPDPLKIQNHCCREPYYQAVPAGTLNCTRQNPWKETQDRKELPHCVPVCGRPVA
PIAQSQEAAGSSRAKLGNFPWQAFTSIYGRGGGALLGDRWILTAAHTIHPKDGVLLGKNR
SVHVFLGHTSIDEMLRRGSHPVRRVVVHPDYRQHESRNFDGDLALLELQRRVPLGPSLLP
VCLPEREALYRSGVWGYVSGFGVDLGWLTTELKYSRLPVAPRAACQAWLQDKQRSEVFSA
NMFCAGDKMRQQSVCQGDSGGVYVVWDERAHHWVATGIVSWGIGCGKGYGFYTKVLNYLD
WIKGVMDGKD
Download sequence
Identical sequences J9P6V1
9615.ENSCAFP00000020784 ENSCAFP00000041384 ENSCAFP00000020784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]