SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9615.ENSCAFP00000021882 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9615.ENSCAFP00000021882
Domain Number 1 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-27
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 2 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 47-96
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.06e-20
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 5 Region: 378-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 174-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000822
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9615.ENSCAFP00000021882
Sequence length 447
Comment (Canis familiaris)
Sequence
METQADCISQEPQALLESALPSSKVPAFSDKDSLGDEMLAAALLKAKSQELVTFEDVAVY
FIRKEWKRLEPAQRDLYRDVMLENYGNVFSLDGETRTEHDQDISEDTGSRGVLLGRFQKD
ISQGLKFEEAYEQDVSLKRQLGNSSGERLDRKIQDFGQMTDEEKLTPGGERSEKYSDFGN
SLTVSSNLISHQRLPVGDRPHKCDECSKSFNRTSDLIQHQRIHTGEKPYECSECGKAFSQ
SSHLIQHQRIHTGEKPYECNDCGKTFSCSSALILHRRIHTGEKPYECNECGKTFSWSSTL
THHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFSQSSHLYQHQ
RIHTGEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHT
GEKPLNVMGMSKSSLRVTAELNIREST
Download sequence
Identical sequences E2RIY1
ENSCAFP00000021882 9615.ENSCAFP00000021882 XP_013969708.1.84170 XP_013969709.1.84170 XP_013969710.1.84170 XP_013969711.1.84170 XP_013969712.1.84170 XP_013969713.1.84170 XP_013969714.1.84170 ENSCAFP00000021882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]