SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9615.ENSCAFP00000022038 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9615.ENSCAFP00000022038
Domain Number 1 Region: 32-121
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.33e-36
Family SCAN domain 0.0000412
Further Details:      
 
Domain Number 2 Region: 438-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.16e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 479-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-19
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 383-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-19
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 344-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-18
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 6 Region: 221-255
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000667
Family KRAB domain (Kruppel-associated box) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9615.ENSCAFP00000022038
Sequence length 543
Comment (Canis familiaris)
Sequence
ERPGMAEDPQQQMGVPVVKLEKELPWGRGREDPSPETFRLRFRQFRYQEAAGPQEALREL
QELCRQWLRPELHTKEQILELLVLEQFLTILPREFYAWIREHGLESGKALVAMVEDFTER
TLEAKAVPCHVQGEQQETALGRGPWEPGVHLGPVEVKPEWGMTHGEGVQGLDQGTEEQLS
QDPGAGTQAFQEQALPVLQAGPGLPPVNSRDQEMAAGFLTAGPQGLGSFKDMALAFPEEE
WRHVTPAQIDCFGEYVEPQDCGVSAPGIGSKEKEAKTQQVDLKGALARVTSERFGEATLQ
SPELGRTCEQEPSSSVGNIPGPPPPQHGVVPLPDDLKTHSSFWKPFQCPECGKGFSRSSN
LVRHQRTHEEEKSYGCVECGKGFTLREYLMKHQRTHLGKRPYVCSECWKTFSQRHHLEVH
QRSHTGEKPYKCGDCWKSFSRRQHLQVHRRTHTGEKPYTCECGKSFSRNANLAVHRRAHT
GEKPYGCQVCGKRFSKGERLVRHQRIHTGEKPYHCPACGRSFNQRSILNRHQKTQHRQET
LAQ
Download sequence
Identical sequences 9615.ENSCAFP00000022038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]