SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9615.ENSCAFP00000023906 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9615.ENSCAFP00000023906
Domain Number 1 Region: 390-626
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.45e-37
Family Calponin-homology domain, CH-domain 0.0000884
Further Details:      
 
Domain Number 2 Region: 87-242,388-437
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.2e-17
Family FAD/NAD-linked reductases, N-terminal and central domains 0.058
Further Details:      
 
Domain Number 3 Region: 1000-1033
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000143
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9615.ENSCAFP00000023906
Sequence length 1058
Comment (Canis familiaris)
Sequence
SMEDSKNETVNHAHVLFDRFVQATTCKGTLKAFQELCDHLELKPKDYRSFYHKLKSKLNY
WKAKALWAKLDKRGSHKDYKKGKACTNTKCLIIGAGPCGLRTAIDLSLLGAKVVVIEKRD
AFSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGAIDHISIRQLQLILLKVALILGIEIHV
NVEFQGLVQPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGFRRKEFRG
KLAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQELKEATGIDLENIVYYKDDTHYF
VMTAKKQSLLDKGVILHDYADTELLLSRENVDQEALLNYAREAADFSTQQQLPSLDFAIN
HYGQPDVAMFDFTCMYASENAALVREQNGHQLLVALVGDSLLEPFWPMGTGIARGFLAAM
DSAWMVRSWSLGTSPLEVLAERESIYRLLPQTTPENVSKNFSQYSIDPVTRYPNININFL
RPSQVRHLYNTGETRDIHLEMENLVNSRTTPKLTRNESVARSSKLLGWCQRQTDGYAGVN
VTDLTMSWKSGLALCAIIHRYRPDLIDFDSLDEQNVEKNNQLAFDIAEKELGISPIMTGK
EMASVGEPDKLSMVMYLTQFYEMFKDSLPSSGKGWQALFMESLPFACTKSAVTNNHSKLG
QTISRKRSPKVNDKKEKDLDGAGKRRKTSQSEEEEAPRGYRGGRPTLVSTLTDRRMDVAL
GNQNKVKYMATQLLAKFEENAPPQSTGMRRQFCLHVLSPNHTWPVCHSRHKSVGSASRPA
AYLSRVTLLPPPSGNSLVSSGTKILRGQDLLKEKEQLMASNLVQAAMWRHTARLSSGELG
TINLLLYLPVGMRGLPAVAYVTHVLFFLKRFELRQRVWQAQPCWLSWHRISFNLGHASCV
NTLAHPSLPSCLLISEVCPASHAKSGKSSLPFPHHSDHLRSSNRPASPSSDSLRQKYIKM
YTGGVSSLAEQIANQLQRKEQPKTLLDKKELGSIKKEFPQNLGGSDTCYFCRKRVYVMER
LSAEGKFFHRSCFKCEYCATTLRLSAYAYDIEDGESLC
Download sequence
Identical sequences 9615.ENSCAFP00000023906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]