SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9615.ENSCAFP00000024416 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9615.ENSCAFP00000024416
Domain Number 1 Region: 124-260
Classification Level Classification E-value
Superfamily Cyclin-like 1.55e-48
Family Cyclin 0.0000603
Further Details:      
 
Domain Number 2 Region: 263-382
Classification Level Classification E-value
Superfamily Cyclin-like 2.15e-38
Family Cyclin 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9615.ENSCAFP00000024416
Sequence length 397
Comment (Canis familiaris)
Sequence
MALLRRPTVSTDLENVDTGVNSKAKSHVTIRRAVLEEIGNRVTTRATQVAKKAQNTKIPV
QLTKTNVNKQLKPTASVKPVQMEMLAPKGPPPALEEISMKEENLCQAFSDALLCKIEDID
QEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGREINGRMRAILVDWLVQVHSKFR
LLQETLYMCIAVMDRFLQVQLVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAY
TSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYFMELTLIDYDMV
HYHPSKVAAAASCLSQKILGQGKWNLKQQYYTGYTENELLEVMQHMAKNVVKVNENLTKF
IAIKNKYASSKLLKISTIPQLNSKAIQELASPLMGRS
Download sequence
Identical sequences E2R8B4
NP_001300739.1.84170 9615.ENSCAFP00000024416 ENSCAFP00000024416 ENSCAFP00000024416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]