SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9615.ENSCAFP00000028490 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9615.ENSCAFP00000028490
Domain Number 1 Region: 36-127
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.41e-38
Family SCAN domain 0.0000382
Further Details:      
 
Domain Number 2 Region: 472-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.46e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 435-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.47e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 514-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000384
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 213-268
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000248
Family KRAB domain (Kruppel-associated box) 0.0044
Further Details:      
 
Domain Number 6 Region: 376-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000688
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9615.ENSCAFP00000028490
Sequence length 583
Comment (Canis familiaris)
Sequence
LAMASGPGPQDREGLLIVKLEEDCAWSQELPPSDPGPSPEASHLRFRRFRFQEAAGPREA
LSRLQELCHEWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVED
MQRELGRLRLQVTNHRRGTEVLLEEPLPLETARESPSFKLEPMETERSPGPRLQELLGPS
PKRDPQAVKERGEEQLSGLVGGSASGAKGDLVLFQLPESLEDVAMYISQEEWGHQDPSKR
ALSRDTVQESYENVDSLESQVPRQEALSTQVERGGKPWDPSLQTCKEGLSPRSPAPGEEK
FENQEEGAQSVSPESIRPQALLPGQARGEVPWSPEQGRPQDRADGHWEPPPEEGMEPSLV
GATSCRELGRPKDLQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVECGEIFGGN
PHFLSLHRTHLGEEAHKCLECGKSFSQNTHLTRHQRTHTGEKPYQCNICGKSFSCNSNLH
RHQRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCAECGKSFSRSSHLVIHER
THEKERLYPFSECGEAVSDSTLFLTNHGTHKAEKKLFECLTCG
Download sequence
Identical sequences 9615.ENSCAFP00000028490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]