SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9615.ENSCAFP00000029815 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9615.ENSCAFP00000029815
Domain Number 1 Region: 204-321
Classification Level Classification E-value
Superfamily SH2 domain 5.39e-24
Family SH2 domain 0.0007
Further Details:      
 
Domain Number 2 Region: 567-723
Classification Level Classification E-value
Superfamily Ras GEF 1.07e-21
Family Ras GEF 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9615.ENSCAFP00000029815
Sequence length 859
Comment (Canis familiaris)
Sequence
MTEGPKKASRKFKFFKFKGLGSLSNLPRSFTLKRSSTSSSIESHLEPDTFEATQDDMVTV
PKSPPAYARSSDMYSHMGTMPRLSIKKARDPQATHKTKEVGLEPHLVAQGLPNPPGLEAA
KEVVVETKPPLEDTPAVGPNPSAMSPTEKPKDPRADRKEERDPRNVPPERVAGEPEAGGD
YVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQRNGDFLI
RDSLTSLGDYVLTCRWRNQALHFKINKVVVKAGESYTHIQYLFEQESFDHVPALVRYHVG
SRKAVSEQSGAIIYCPVNRTFPLRYLEACYGLGQGSSKAASPASPSGPKGGHMKRRSVTM
TDGLTADKVTRSSDGCPASTSLPHPRESIRNCALSMDQIPDLHSPMSPISESPSSPAYST
VTRVHATSAAPSATALPASPVTRRSSEPQLCPGSTPKPPGESDKGPYASPSHTLCKASPS
PSLSSYSDPDSGHYCQLQPPVRGSREWAMAEASGRQARSYGERLKELSENGASEGDWGRA
FTAPVVEATSSFNPATFQSLLIPKDNRPLEVGLLRKVKELLAEVDARTLARHVTKVDCLV
ARILGVTKEMQTLMGVRWGMELLTLPHGRQLRLDLLERFHTMSIMLAVDILGCTGSAEER
AALLHKTIQLAAELRGTMGNMFSFAAVMGALDMAQIARLEQTWVTLRQRYTEGAILYEKK
LKPFLKSLNEGKEGPPLSNTTFPHVLPLITLLECDSAPAEGPEPWGSTEHGVEVVLAHLE
AARTVAHHGGLYHTNAEVKLQGFQARPELLEVFSTEFQMRLLWGSQGASSNQARRYEKFD
KVLTALSHKLEPAVRSSEL
Download sequence
Identical sequences E2RRA8
9615.ENSCAFP00000029815 ENSCAFP00000029815 ENSCAFP00000029815 XP_548447.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]