SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000000010 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000000010
Domain Number 1 Region: 7-49
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000000422
Family Eukaryotic proteases 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000000010
Sequence length 50
Comment (Felis catus)
Sequence
MVYLQSSPEPCVGTLIHPEWVLTAAHCPLPVKIRLGVYQPSVKNKKEQIR
Download sequence
Identical sequences ENSFCAP00000000010 9685.ENSFCAP00000000010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]