SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000001438 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000001438
Domain Number 1 Region: 508-604
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.73e-38
Family Eukaryotic proteases 0.0000554
Further Details:      
 
Weak hits

Sequence:  9685.ENSFCAP00000001438
Domain Number - Region: 112-136
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00049
Family Pan module (APPLE domain) 0.031
Further Details:      
 
Domain Number - Region: 22-45
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00412
Family Pan module (APPLE domain) 0.056
Further Details:      
 
Domain Number - Region: 202-225
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0294
Family Pan module (APPLE domain) 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000001438
Sequence length 606
Comment (Felis catus)
Sequence
CVTKLFTDTGFQGGDVTTIFSPSAKHCQLICTHHPRCLLFTFMADSSSEDPXXXFTCILK
DSVTETLPRVNMTGAISGYSFKQCPHQISACHRNLYVDLDMKGMNYNSLMTRDAQECQER
CTNDVHCHFFTYATRQFPSTEHRNICLLKYTHMGTPTRIMKLTKVVSGFSLKSCALSKLA
CIRDIFPSTAFADSNIDSVMAPDVFVCRRICTHHPGCLFFTFLSQEWPKESEXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXKIQNTLQKANVPLVTTEECQTRYRGHKITNKML
CAGYQEGGKDACKGDSGGPLSCKHNDVWHLVGITSWGEGCGQRERPGVYTNVVEYVDWIL
EKTQAV
Download sequence
Identical sequences 9685.ENSFCAP00000001438 ENSFCAP00000001438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]