SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000002033 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000002033
Domain Number 1 Region: 853-1157
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.34e-94
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000543
Further Details:      
 
Domain Number 2 Region: 2-161
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.75e-35
Family MAM domain 0.00000659
Further Details:      
 
Domain Number 3 Region: 361-560
Classification Level Classification E-value
Superfamily Fibronectin type III 2.33e-27
Family Fibronectin type III 0.00079
Further Details:      
 
Domain Number 4 Region: 1136-1213
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.00000000000766
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0057
Further Details:      
 
Domain Number 5 Region: 288-396
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000123
Family Fibronectin type III 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000002033
Sequence length 1214
Comment (Felis catus)
Sequence
GCTFEEASDPAVPCEYSQAQYDDFQWDQVQIHPGTRAPADLPHGSYLMVNASQHAPGQRA
HVIFQSLSENDTHCVQFSYFLYSRDGHSPGTLGIYVRVNGGPLGSAVWNMTGSHGRQWHQ
AELAVSTFWPNEYQVLFEALISPDRRGYMGLDDILLLSYPCAKAPHFSRLGDVEVNAGQN
ASFQCMAAGRAAEAERFLLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSIIGDGPIVRKEIEYR
MSRGPWAEVHAVSLQTYKLWHLDPDTEYEISVLLTRPGDGGTGRPGPPLISRTKCAEPMR
APKGLAFAEIQARQLMLQWEPLGYNVTRCHTYTVSLCYHYTLGSSHNQTIRECVKMERGV
SRYTIKNLPPYRNVHVRLILTNPEGRKEGKEVTFQTDEDVPGGIAAESLTFTPLEDMIFL
KWEEPQEPNGLITQYEISYQSIESSDPAVNVPGPRRTISKLRNETYHVFSNLHPGTTYLF
SVRARTGKGFGQAALTEITTNISAPSFDYADMPSPLGESENTITVLLRPAQGRGAPISVY
QVIVEEERPRRLRREPGSQDCFPVPLTFDAALARGLVHYFGAELAASSLPEAMPFTVGDN
QTYRGFWNPPLEPRKAYLIYFQATSHLKGETRLNCIRIARKAACKESKRPLEVSQRSEEM
GLILGICAGGLAVLILLLGAIIIIIRKGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDQRSGGVTEASSLLGGSPRRPCGRKGSPY
HTGQLHPAVRVADLLQHINQMKTAEGYGFKQEYESFFEGWDATKKKDKVKGSRPEPVPAY
DRHRVKLPPMLGGPDADYINANYIDGYHRSNHFIATQGPKPEMVYDFWRMVWQEHCSSIV
MITKLVEVGRVKCSRYWPEDSDMYGDIKITLVKTETLAEYVVRTFALERRGYSARHEVRQ
FHFTAWPEHGVPYHATGLLAFIRRVKASTPPDAGPVVIHCSAGTGRTGCYIVLDVMLDMA
ECEGVVDIYNCVKALCSRRVNMIQTEEQYIFIHDAILEACLCGETTIPVSEFKATYKEMI
RIDPQSNSSQLREEFQTLNSVTPPLDVEECSIALLPRNRDKNRSMDVLPPDRCLPFLIST
DGDPNNYINAALTD
Download sequence
Identical sequences ENSFCAP00000002033 9685.ENSFCAP00000002033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]