SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000002807 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000002807
Domain Number 1 Region: 262-361
Classification Level Classification E-value
Superfamily HMG-box 7.99e-24
Family HMG-box 0.00000176
Further Details:      
 
Domain Number 2 Region: 535-633
Classification Level Classification E-value
Superfamily HMG-box 2.23e-22
Family HMG-box 0.00000378
Further Details:      
 
Domain Number 3 Region: 83-165
Classification Level Classification E-value
Superfamily HMG-box 3.4e-21
Family HMG-box 0.00000347
Further Details:      
 
Domain Number 4 Region: 372-449
Classification Level Classification E-value
Superfamily HMG-box 5.5e-17
Family HMG-box 0.00000922
Further Details:      
 
Domain Number 5 Region: 460-539
Classification Level Classification E-value
Superfamily HMG-box 0.0000000000000017
Family HMG-box 0.00000577
Further Details:      
 
Weak hits

Sequence:  9685.ENSFCAP00000002807
Domain Number - Region: 660-677
Classification Level Classification E-value
Superfamily ARM repeat 0.0253
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000002807
Sequence length 744
Comment (Felis catus)
Sequence
RWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKVAFKDFSGDMCKLKWVEISNEVR
KFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNL
DLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFREDHPDLIQNAKKSDIPEKPK
TPQQLWYTHEKKVYLKVRPDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEIM
RDYIQKHPELNISEEGITKSTLTKAERQLKDKFDGRPTKPPPNSYSLYCAELMANMKDVP
STERMVLCSQQWKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKML
SINKKQATSPASKKPSQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRL
LARMWNDLSEKKKAKYKAREAALKAQSERKPGGDREERGKLPESPKRAEEIWQQSVIGDY
LARFKNDRVKALKAMEMTWNNMEKKEKLMWIKKAAEDQKRYERELSEMRAPPAAANSSKK
MKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAE
EQQKQYKVHLDLWVKSLSPQDRAAYKEYISNKRKSMTKLRGPNPKSSRTALQSKSESEED
EDEDEDDEDEDEEEEEDENGDSSEDGGDSSESSSEDESEDGDENEEDDEDEDDDEDDDED
EDNESEGSSSSSSSSGDSSDSDSN
Download sequence
Identical sequences 9685.ENSFCAP00000002807 ENSFCAP00000002807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]