SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000003280 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000003280
Domain Number 1 Region: 49-140
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.48e-39
Family SCAN domain 0.0000508
Further Details:      
 
Domain Number 2 Region: 441-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-27
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 386-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.59e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 487-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 225-278
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000129
Family KRAB domain (Kruppel-associated box) 0.0096
Further Details:      
 
Domain Number 6 Region: 355-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000381
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000003280
Sequence length 563
Comment (Felis catus)
Sequence
MMTAESREATGLSPQAAQEKDGIVIVKVEEEDEEDHMWGQDSSLQETPPPDPEIFRQRFR
HFCYQNTFGPREALSRLKELCHQWLRPEINTKEQILELLVLEQFLSILPKELQVWLQEYR
PDSGEEAVTLLEDLELDLSGQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMVKIEDMAVSLILEE
WGCQNLARRNLNRDNRQENYGNVFSQGCENRNENEESASKAENAEDSASRGETTGRFQKD
FAEKREQQGRIVERQQRNPEEKTGREKRDSGPATVKEKKPTTGERGPREKGKGLGRSFSL
SSNFNTPEEVPTGTKSHRCDECGKCFTRSSSLIRHKIIHTGEKPYECSECGKAFSLNSNL
VLHQRIHTGEKPHECNECGKAFSHSSNLILHQRIHSGEKPYECNECGKAFSQSSDLTKHQ
RIHTGEKPYECSECGKAFNRNSYLILHRRIHTREKPYKCTKCGKAFTRSSTLTLHHRIHT
RERAPEYSPASLDAFGAFLKSCV
Download sequence
Identical sequences 9685.ENSFCAP00000003280 ENSFCAP00000003280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]